ACTH CAS NO.16961-83-4

Min.Order: 1 Kilogram
Payment Terms: L/C,T/T,

Product Details

Keywords

16961-83-4
ACTH
F6H2Si

Quick Details

ProName: ACTH
CasNo: 16961-83-4
Molecular Formula: F6H2Si
Appearance: conform
Application: intermediate
DeliveryTime: with 10 days after order confirmed
PackAge: as per buyers
Port: Any port of China
ProductionCapacity: 1 Metric Ton/Day
Purity: 99%
Storage: R.T.
Transportation: by air/sea
LimitNum: 1 Kilogram
Grade: Industrial Grade,Food Grade,Pharma Gra...

Superiority

Our company was built in 2009 with an ISO certificate.In the past 5 years, we have grown up as a famous fine chemicals supplier in China and we had established stable business relationships with Samsung,LG,Merck,Thermo Fisher Scientific and so on.Our main business covers the fields below:

1.Noble Metal Catalysts (Pt.Pd...)

2.Organic Phosphine Ligands (Tert-butyl-phosphine.Cyclohexyl-phosphine...)

3.OLED intermediates (Fluorene,Carbazole,Boric acid...)

4.Customs Synthesis

Our advantage:

1. Higest quality and good package

2.Fast delivery

3.Better payment term

4.Fast response to customer within 6 hours

5.Good business credit in Europe ,US ,Japan ,Korea

Anyway ,if you need any chemicals from China ,Henan Tianfu can help you

Details

Hexafluorosilicic acid Basic information

Product Name:	Hexafluorosilicic acid
Synonyms:	SILICOFLUORIC ACID;SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF;SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE;SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE HUMAN;HYDROGEN HEXAFLUOROSILICATE;HYDROFLUOROSILICIC ACID;HYDROFLUOSILICIC ACID;HYDROSILICOFLUORIC ACID
CAS:	16961-83-4
MF:	F6H2Si
MW:	144.09
EINECS:	241-034-8
Product Categories:	Inorganics;Acids;Electronic Chemicals;Micro/Nanoelectronics;peptide;Fluoride
Mol File:	16961-83-4.mol

Hexafluorosilicic acid Chemical Properties

bp	108-109°C
density	1.22 g/mL at 25 °C
refractive index	1.3500
Fp	108-109°C
storage temp.	−20°C
solubility	H₂O: 1 mg/mL, clear, colorless
Merck	14,4182
Stability:	Stable in aqueous solution.
CAS DataBase Reference	16961-83-4(CAS DataBase Reference)
EPA Substance Registry System	Silicate(2-), hexafluoro-, dihydrogen(16961-83-4)

Safety Information

Hazard Codes	C
Risk Statements	34-35-20/21/22
Safety Statements	26-36/37/39-45-27
RIDADR	UN 1778 8/PG 2
WGK Germany	3
RTECS	VV8225000
F	8-10
Hazard Note	Corrosive
TSCA	Yes
HazardClass	8
PackingGroup	II
Hazardous Substances Data	16961-83-4(Hazardous Substances Data)

MSDS Information

Provider	Language
SigmaAldrich	English
ACROS	English
ALFA	English

Hexafluorosilicic acid Usage And Synthesis

Chemical Properties	colourless liquid; often supplied as a colourless solution in water
General Description	A colorless fuming liquid with a penetrating pungent odor. Corrosive to metals and tissue. Both the fumes and very short contact with the liquid can cause severe and painful burns. Used in water fluoridation, in hardening cement and ceramics, as a wood preservative.
Air & Water Reactions	Fumes in air. Soluble in water with release of heat and corrosive fumes.
Reactivity Profile	Hexafluorosilicic acid can react with strong acids (such as sulfuric acid) to release fumes of toxic hydrogen fluoride. Attacks glass and materials containing silica. Reacts exothermically with chemical bases (examples: amines, amides, inorganic hydroxides). Reacts with active metals, including iron and aluminum to dissolve the metal and liberate hydrogen and/or toxic gases. Can initiate polymerization in certain alkenes. Reacts with cyanide salts and compounds to release gaseous hydrogen cyanide. Flammable and/or toxic gases are also often generated by reactions with dithiocarbamates, isocyanates, mercaptans, nitrides, nitriles, sulfides, and weak or strong reducing agents. Additional gas-generating reactions may occur with sulfites, nitrites, thiosulfates (to give H2S and SO3), dithionites (SO2), and carbonates. Can catalyze (increase the rate of) chemical reactions. Decomposes when heated to the boiling point to produce very toxic and corrosive hydrogen fluoride gas.
Health Hazard	Inhalation of vapor produces severe corrosive effect on mucous membrane. Ingestion causes severe burns of mouth and stomach. Contact with liquid or vapor causes severe burns of eyes and skin.
Fire Hazard	Special Hazards of Combustion Products: Irritating fumes of hydrogen fluoride may form in fire.